SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031362 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031362
Domain Number 1 Region: 127-318
Classification Level Classification E-value
Superfamily vWA-like 5.34e-61
Family Integrin A (or I) domain 0.0000674
Further Details:      
 
Domain Number 2 Region: 2297-2502
Classification Level Classification E-value
Superfamily vWA-like 3.26e-57
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1175-1378
Classification Level Classification E-value
Superfamily vWA-like 4.75e-57
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 1.36e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2519-2722
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.81e-33
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 6 Region: 1938-2104
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1754-1924
Classification Level Classification E-value
Superfamily Fibronectin type III 3.31e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 1568-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 1.74e-21
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 9 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 4.04e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 10 Region: 1387-1563
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 11 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-20
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 12 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 13 Region: 2117-2202
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 8.7e-18
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 15 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000171
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 16 Region: 2207-2290
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000022
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031362   Gene: ENSPTRG00000018351   Transcript: ENSPTRT00000033939
Sequence length 3063
Comment pep:known chromosome:CHIMP2.1.4:6:75427296:75549920:-1 gene:ENSPTRG00000018351 transcript:ENSPTRT00000033939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWAKPVDPIVGYRITVD
PTTDGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKP
VEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLIAMEVSSKYVKLNWNPSPSP
VTGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLSFSEVTSYGFKTNWSPAGENVF
SYHITYKEAAGDDEVTVVEPASSTSVVLSSLKPETLYLVNVTAEYEDGFSIPLAGEETTE
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYRPVAGGESREVTTPPNQRRRTLE
NLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK
VKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAGDALFGEGT
TLEERGSPQDLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVDTGEKNLPEDAIHT
MIENLQPETKYRISVFATYSSGEGEPLTGDATTELSQDSKTLKVDEETENTMRVTWKPAP
GKVVNYRVVYRPHGRGKQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPMGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFDIGPKRVQIALAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVK
GPGDLEAPSNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRMETSTV
LKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMHVQWQPVGGA
TGYILSYKPVKDTEPTRPKEVRLGPTVNDMQLTDLVPNTEYAVTVQAVLHDLTSEPVTVR
EVTLPLPRPQDLKLRDVTHSTMNVFWEPVPGKVRKYIVRYKTPEEDVKEVEVDRSETSTS
LKDLFSQTLYTVSVSAVHDEGESPPVTAQETTRPVPAPTNLKITEVTSEGFRGTWDHGAS
DVSLYRITWAPFGSSDKMETILNGDENTLVFENLNPNTVYEVSITAIYPDESESDDLIGS
ERTLPILTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTTT
IGGRQNSVVLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTSTL
NVRWDHAEGNPRQYKLFYAPAAGGPEELVPIPGNTNYAILRNLQPDTSYTVTVVPVYTEG
DGGRTSDTGRTLMRGLARNVQVYNPTPNSLDVRWDPAPGPVLQYRIVYSPVDGTRPSESI
VVPGNTRMVHLERLIPDTLYSVNLVALYSDGEGNPSPTQGRTLPRSGPRNLRVFGETTNS
LSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAVYE
DGDGGHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPME
AFVGEMTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQIGWDTF
CVKWSPHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPDTDYGVTVFVQTPNLE
GPGVSVKEHTTVKPTEAPTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNFN
KVVKFIFNTVGGFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGGN
TRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFVVGV
ADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPG
FKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRIQKNAFVNQPTADLHPNGLPPSYTII
LLFRLLPETPSDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTEEV
KTLFYGSFHKVHIVVTSKSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKSAA
FQIQSFDIVCSPVWTSRDRCCDIPSRRDEGKCPAFPNSCTCTQDSVGPPGPPGPAGGPGA
KGPRGERGISGAIGPPGPRGDIGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGLP
GRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDH
GRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYQSSRNQ
PGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGTGSPGPRGLP
GPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYP
GSG
Download sequence
Identical sequences H2QTA4
ENSPTRP00000031362 XP_001142912.1.37143 9598.ENSPTRP00000031362 ENSPTRP00000031362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]