SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031403 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031403
Domain Number 1 Region: 61-344
Classification Level Classification E-value
Superfamily L domain-like 2.32e-41
Family Ngr ectodomain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031403   Gene: ENSPTRG00000018376   Transcript: ENSPTRT00000033983
Sequence length 420
Comment pep:known chromosome:CHIMP2.1.4:6:82914766:82916028:1 gene:ENSPTRG00000018376 transcript:ENSPTRT00000033983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
NHIVPPEDEQQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRYLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
Download sequence
Identical sequences H2QTB7
ENSPTRP00000031403 ENSPTRP00000031403 9598.ENSPTRP00000031403 XP_016811400.1.37143 XP_016811401.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]