SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031493 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031493
Domain Number 1 Region: 329-604
Classification Level Classification E-value
Superfamily RNI-like 7.46e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.0073
Further Details:      
 
Domain Number 2 Region: 265-332
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000955
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031493   Gene: ENSPTRG00000018438   Transcript: ENSPTRT00000034076
Sequence length 621
Comment pep:known chromosome:CHIMP2.1.4:6:99769103:99842420:-1 gene:ENSPTRG00000018438 transcript:ENSPTRT00000034076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRTIESNSRTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTALHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDAVVLHGVKDKPVISLKTSL
IDINDREDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLGDTSLEFLQSRCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLARQLPNLQKLFL
TANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNASFPKVFIKKSFTQ
Download sequence
Identical sequences H2QTF8
ENSPTRP00000031493 XP_001136579.1.37143 XP_518648.2.37143 9598.ENSPTRP00000031493 ENSPTRP00000031493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]