SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031624 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031624
Domain Number 1 Region: 1636-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-35
Family Laminin G-like module 0.0005
Further Details:      
 
Domain Number 2 Region: 1458-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1049-1229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-22
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 1229-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.37e-20
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 5 Region: 833-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-18
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family Laminin-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031624
Domain Number - Region: 712-800
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0209
Family Chemotaxis phosphatase CheZ 0.023
Further Details:      
 
Domain Number - Region: 465-688
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031624   Gene: ENSPTRG00000018514   Transcript: ENSPTRT00000034215
Sequence length 1823
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:113226383:113374469:-1 gene:ENSPTRG00000018514 transcript:ENSPTRT00000034215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFRTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLEGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGSPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNHVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSEIDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPISSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDMLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTFTQNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKRGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVLVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences 9598.ENSPTRP00000031624 ENSPTRP00000031624 ENSPTRP00000031624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]