SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031627 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031627
Domain Number 1 Region: 87-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-43
Family SPRY domain 0.0000588
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000133
Family RING finger domain, C3HC4 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031627   Gene: ENSPTRG00000018515   Transcript: ENSPTRT00000034218
Sequence length 263
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:113467634:113471603:1 gene:ENSPTRG00000018515 transcript:ENSPTRT00000034218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRLQAELSCPVCLDFFSSSISLSCSHVFCFDCIQRHMLENRDFRAMCPLCRDVVKVPA
LEEWQVSVLTLMIKQHNNQFEQSLHVREEHRHFREDVTLDAATASSLLVFSNDLRSAQCE
KIHHDLTKYPRLTCVLGTPCFSSGQHYWEVEVGEVKSWSLGVCKESADRKSNDLFPEHGF
WISMKAGAIHANTDLERIPASPRLRRVGIFLDFDLEEIQFFDVDNNVLIYTHDDFFSLEL
LRPFFCLELLGEGESGNVLTICP
Download sequence
Identical sequences 9598.ENSPTRP00000031627 ENSPTRP00000031627 XP_001159819.1.37143 ENSPTRP00000031627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]