SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031664 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031664
Domain Number 1 Region: 261-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 153-251
Classification Level Classification E-value
Superfamily LCCL domain 3.01e-25
Family LCCL domain 0.00082
Further Details:      
 
Domain Number 3 Region: 40-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-25
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031664   Gene: ENSPTRG00000018545   Transcript: ENSPTRT00000034258
Sequence length 715
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:118610780:118677779:1 gene:ENSPTRG00000018545 transcript:ENSPTRT00000034258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPXPPXXXPLXPPXGPGLLTKLLAVSAPKKKQAEELGDGCGHLVTYQDSGTMTSKNYPG
TYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKE
LLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRD
VAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRD
GSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWA
SGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKNNNSKWKTYKG
IVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDS
LVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTVAIPLVLLVVLVFAGMGIFAAF
RKKKKKGSPYGSAEAQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQKLDLITSDMADY
QQPLMIGTGTVTRKGSTFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEY
ATPIVERHLLRAHTFSAQSGYRVPGPQPGHKHSLSSGGFSPVAGVGAQDGDYQRPHSAQP
ADRGYDRPKAVSAFATESGHSDSQKPPTHPGTSDSYSAPRDCLTPLNQTAMTALL
Download sequence
Identical sequences ENSPTRP00000031664 ENSPTRP00000031664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]