SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031882 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031882
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000268
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 2 Region: 608-654
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031882   Gene: ENSPTRG00000018682   Transcript: ENSPTRT00000034492
Sequence length 745
Comment pep:known chromosome:CHIMP2.1.4:6:147295497:147312571:-1 gene:ENSPTRG00000018682 transcript:ENSPTRT00000034492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPC
LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSKPREQISVKSSVPEIPHANGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLNTSVPNDMDEQQDARESLEDQNLKDQDHLY
EEEIGAVGGIDYNDTNQNAQSEQNGSSDLLCDLNTSSYDTSALCNGFPLENICTQVIDQN
QNLHGDSKQSNLTNGDCVASSDGTSKPSSSLAVAAQLREIIPSSALPNGTVQHILMPDDE
GEGELCWKKVDLGDMKNVDVLSFSHAPSFNFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
QGIDLITAALLFCLGDSPGGRGISDSRMADIYHIDVGTQTFSLPSAILATSTMVGEIASA
SACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKNVH
GDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSIQGAKIIHDRHLRSFGVQPCVSTVLVEP
ARNCVLGLHNDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSKLMRDVCGSLLQSRGMVILQ
WGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIP
LPCMCVTRELTKEGRSLRSVLKPVL
Download sequence
Identical sequences K7CNI8
ENSPTRP00000031882 ENSPTRP00000031882 9598.ENSPTRP00000031882 XP_518784.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]