SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032356 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032356
Domain Number 1 Region: 1182-1227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 1361-1394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000032356
Domain Number - Region: 1458-1490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000328
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1490-1521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000908
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1426-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1394-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00699
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1522-1553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1554-1586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0349
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1218-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0366
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032356   Gene: ENSPTRG00000018938   Transcript: ENSPTRT00000035011
Sequence length 1596
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:10939036:11016877:-1 gene:ENSPTRG00000018938 transcript:ENSPTRT00000035011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGACVLVIALMFLAWGEAQECSPGGHQFLRSPYRSVHFDSWHLQQSAVQDLICDHSLS
PGWYRFLIFDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLF
STTKDCCFFQIPVSVRNCGNFFVYLLQPTQGCMGYCAEAISDARLHPCGSDETEIGGDCV
RQLTASLPPPPAGRPKVLVELIESRLFCRCSFDVPATKNSVGFHIAWSRLSSQEVKEELT
QETTVQAFSLLELDGINLRLGDRIFCSASVFFLANPHVQSVAIESQEFFAGIKLQPELST
ISEDGKEYYLRIESTVPIICSEFSELDQECKISLKLKTIDQGREHLGLNLALSSCHVDLL
QTSSCANGTCSHTFVYYTAVTDFSRDGDRVTNIVVQPIVNEDFLWNNYIPDSIQIKVKDV
PTAYCYSFTDPHIITFDGRVYDNFKTGTFVLYKSMSRDSEVHVRQWDCGSLHYPVSCNCG
FVAQEGGDIVTFDMCNGQLRESQPYLFVKSQDVTRNIKISESYLGRKVTIWFSSGAFIRA
DLGEWGMSLTIRAPSVDYRNTLGLCGTFDENPENDFHDKNGMQIDQNFNNYVAFINEWRI
LPGKSMFDTLPVSMTSPGKPSYCSCSLDTAAYPSSEDLDSVSRSEIALGCKDLSHVSLSS
LIPELDVTSEYINSDTLVREINKHTSPEEYNVNFFLQEKKHINLTKLGLNVQKHPGNEKQ
DSLQYLANKKYTQGRGSHSQEMRYNRQNRWKRQNFHEFPPLFAFPSLGQTDLEELTYFFP
EDHAEDVQQEFFPSWPTPSGLTEYSTLTLCQETLANSSIGRLCLAFLGKRLDSVIEMCVR
DVLLKDDLSWAEAGVALLENECEKRIVEEGKYNTEEYGTSIEDILSVLKCPNLCSGNGQC
MEWGCACSPSSSSYDCSDSYDKAPEITELGNAGFCDVQKYNCMMVRVFGKGFKELPSIKC
EVTKLQYNSSEWMPGEPIYTQTVFHNSRAVDCQLPTDVQQFDTMDLVGGKPTGKWQLKVS
NDGYKFSNPKIMVIYDGACQVCGLYKNDSCTIKENVCIIDGLCYVEGDKNRTSPCLICRP
KISRFTWSFLENNQPPVIEALQDKLQTFYGENFEYQFVAFDPEGSDIHFTLDSGPEGASV
SSAGLFMWKTDLLTTQQFTLRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSG
VYLCVCLPGFHGSLCEVDISGCQSNPCGLGSCISGFHSYSCDCPPELKVETQFVNKFTTQ
TVVLTRSDKSVNKEEDDKNAPGRKRHVKPTSGNAFTICKYPCGKSRECVAPNICKCKPGY
IGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTC
PYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPN
TCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRCQKSICDPTCMNGGKC
VGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQTPICNPKCLY
GGRCIFPNVCSCRTEYSGVKCGKKIQIRRHSVASTI
Download sequence
Identical sequences ENSPTRP00000032356 ENSPTRP00000032356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]