SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032370 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032370
Domain Number 1 Region: 169-243
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-26
Family Homeodomain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000032370
Domain Number - Region: 67-122
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0994
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032370   Gene: ENSPTRG00000018946   Transcript: ENSPTRT00000035026
Sequence length 302
Comment pep:known chromosome:CHIMP2.1.4:7:14196296:14271836:-1 gene:ENSPTRG00000018946 transcript:ENSPTRT00000035026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGS
SPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSE
VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKW
KRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANEDSHDSDHSSEHA
HL
Download sequence
Identical sequences H2QU74
ENSPTRP00000032370 XP_003825056.1.60992 XP_518979.2.37143 9598.ENSPTRP00000032370 ENSPTRP00000032370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]