SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032587 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032587
Domain Number 1 Region: 157-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000105
Family VWC domain 0.018
Further Details:      
 
Domain Number 2 Region: 284-359
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000178
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 99-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000067
Family VWC domain 0.006
Further Details:      
 
Domain Number 4 Region: 62-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000492
Family VWC domain 0.044
Further Details:      
 
Domain Number 5 Region: 236-289
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000345
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032587   Gene: ENSPTRG00000019072   Transcript: ENSPTRT00000035249
Sequence length 625
Comment pep:known chromosome:CHIMP2.1.4:7:32456182:32693796:1 gene:ENSPTRG00000019072 transcript:ENSPTRT00000035249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAVKQRGACCEQCKGCTYEGNTYNSSFK
WQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQ
PEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKV
CKFGNKIFRDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIKVHWEPQQNCA
Download sequence
Identical sequences ENSPTRP00000032587 ENSPTRP00000032587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]