SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032763 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000032763
Domain Number - Region: 239-352
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0247
Family APC10-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032763   Gene: ENSPTRG00000019175   Transcript: ENSPTRT00000035438
Sequence length 357
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:46590905:46632141:-1 gene:ENSPTRG00000019175 transcript:ENSPTRT00000035438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLL
VGLLNHQWLKETDVPQKSRQLYAIVAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNF
RQILFLIKQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDLDHTEEVSNLVNYVLKKLRED
QVKMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCW
AFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
GQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI
Download sequence
Identical sequences H2QUK0
XP_003318470.1.37143 XP_016812927.1.37143 ENSPTRP00000032763 ENSPTRP00000032763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]