SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032885 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032885
Domain Number 1 Region: 329-629
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.44e-92
Family beta-glycanases 0.0000000000162
Further Details:      
 
Domain Number 2 Region: 24-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-59
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000000208
Further Details:      
 
Domain Number 3 Region: 226-328
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.59e-29
Family beta-Galactosidase/glucuronidase domain 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032885   Gene: ENSPTRG00000019244   Transcript: ENSPTRT00000035574
Sequence length 651
Comment pep:known chromosome:CHIMP2.1.4:7:64465805:64487427:-1 gene:ENSPTRG00000019244 transcript:ENSPTRT00000035574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTMDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKALDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPFT
Download sequence
Identical sequences H2QUN2
ENSPTRP00000032885 XP_001138883.1.37143 XP_016801308.1.37143 ENSPTRP00000032885 9598.ENSPTRP00000032885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]