SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032928 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032928
Domain Number 1 Region: 287-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-51
Family SPRY domain 0.0000968
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 5.96e-19
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000133
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032928   Gene: ENSPTRG00000019269   Transcript: ENSPTRT00000035621
Sequence length 487
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:73788376:73803883:1 gene:ENSPTRG00000019269 transcript:ENSPTRT00000035621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQVSLPELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAV
DGSSSPPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHH
PVTPVSTVYSRMKEELAALIAELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEF
IRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDP
ATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASCGFSCGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHY
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLS
PEQPTKL
Download sequence
Identical sequences A0A2I3SED5
ENSPTRP00000032928 9598.ENSPTRP00000032928 XP_001144726.1.37143 XP_016813104.1.37143 XP_016813105.1.37143 XP_527777.2.37143 ENSPTRP00000032928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]