SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033004 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033004
Domain Number 1 Region: 14-175
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000109
Family PBS lyase HEAT-like repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033004   Gene: ENSPTRG00000019303   Transcript: ENSPTRT00000035701
Sequence length 204
Comment pep:novel chromosome:CHIMP2.1.4:7:70887420:70894919:-1 gene:ENSPTRG00000019303 transcript:ENSPTRT00000035701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFSMLRKLPKVTCRDVLPEIRAICIEEIGCWMQSYSTSFLTDSYLKYIGWTLHDKHREV
RVKCVKALKGLYGNRDLTARLELFIGRFKDWMVSMIVDRYSVAVEAVRLLILILKLFYPE
CEIRTMGGREQCQSPGAQRTFFQLLLSFFVESKLHDHAAYLVDNLWDCAGTQLKDWEGLT
SLLLEKDQSTCHMEPGPGTFHLLG
Download sequence
Identical sequences ENSPTRP00000033004 ENSPTRP00000033004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]