SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033281 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033281
Domain Number 1 Region: 224-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000001
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 144-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000033281
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00105
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033281   Gene: ENSPTRG00000019453   Transcript: ENSPTRT00000036004
Sequence length 269
Comment pep:known chromosome:CHIMP2.1.4:7:99983873:100002306:1 gene:ENSPTRG00000019453 transcript:ENSPTRT00000036004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSVGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Download sequence
Identical sequences H2QV04
XP_003815761.1.60992 XP_519234.3.37143 ENSPTRP00000033281 ENSPTRP00000033281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]