SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033370 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033370
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 3.97e-40
Family Internalin LRR domain 0.035
Further Details:      
 
Domain Number 2 Region: 539-631
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-25
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033370   Gene: ENSPTRG00000028467   Transcript: ENSPTRT00000036097
Sequence length 683
Comment pep:known chromosome:CHIMP2.1.4:7:101185274:101197381:-1 gene:ENSPTRG00000028467 transcript:ENSPTRT00000036097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVATPLAAGGEEAAATTSVPGSPGLPGRRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSLLPPYICQLPLRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLPSELCG
LSSLRDLNVRRNQLSTLPEELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQVCLKGKLHIFKYLSTEAGQRGSALGDLAPSRPPSFSPCPAEDLFPGHRYDGGLDS
GFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSH
VPGEDEERGTVEEQRPPELSPGAGDRERAPSSRREEPAGEERRRPDTLQLWQERERRQQQ
QSGAWGAPRKDSLLKPGLRAVVGGAAAVSTQAMHNGPPKSSASQAGAAAGQGAPAPAPAS
QEPLPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDL
MTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKA
RKNVESFLEACRKMGVPEADLCSPSDLLQGTARGLRTALEAVKRVGGKALPPLWPPSGLG
GFVVFYVVLMLLLYVTYTRLLGS
Download sequence
Identical sequences H2QV32
ENSPTRP00000033370 ENSPTRP00000033370 XP_009452074.1.37143 XP_016801659.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]