SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033376 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033376
Domain Number 1 Region: 259-465
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.14e-24
Family Regulator of chromosome condensation RCC1 0.0038
Further Details:      
 
Domain Number 2 Region: 28-115
Classification Level Classification E-value
Superfamily F-box domain 1.57e-18
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033376   Gene: ENSPTRG00000019496   Transcript: ENSPTRT00000036103
Sequence length 580
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:101197560:101212412:1 gene:ENSPTRG00000019496 transcript:ENSPTRT00000036103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKCLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREQQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVRYLQRPVTLWCGLNHSL
VLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSH
DIEQHAPYRDLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRMEKMK
EIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET
Download sequence
Identical sequences H2QV34
ENSPTRP00000033376 ENSPTRP00000033376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]