SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033400 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033400
Domain Number 1 Region: 609-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-79
Family Protein kinases, catalytic subunit 0.000000000646
Further Details:      
 
Domain Number 2 Region: 17-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-64
Family Ephrin receptor ligand binding domain 0.0000000079
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-33
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 905-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 250-320,361-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000432
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033400   Gene: ENSPTRG00000019507   Transcript: ENSPTRT00000036127
Sequence length 987
Comment pep:known chromosome:CHIMP2.1.4:7:101412857:101437776:-1 gene:ENSPTRG00000019507 transcript:ENSPTRT00000036127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY
Download sequence
Identical sequences H2QV43 P54760 Q541P7
ENSP00000350896 hso002002342.1 gi|32528301|ref|NP_004435.3| ENSP00000350896 ENSPTRP00000033400 ENSPTRP00000033400 9606.ENSP00000350896 NP_004435.3.87134 NP_004435.3.92137 XP_016801693.1.37143 XP_519269.3.37143 ENSP00000350896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]