SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033449 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033449
Domain Number 1 Region: 224-357
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-40
Family Pleckstrin-homology domain (PH domain) 0.000000858
Further Details:      
 
Domain Number 2 Region: 460-566
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-24
Family SH2 domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 63-123
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.57e-22
Family Adapter protein APS, dimerisation domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033449   Gene: ENSPTRG00000019534   Transcript: ENSPTRT00000036181
Sequence length 678
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:102891820:102928421:1 gene:ENSPTRG00000019534 transcript:ENSPTRT00000036181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSYCPAHGFPSQDPLWPLSSQQWSSAHYSEPEAAGGCDGTEAMNGAGPGPAAAAPVPV
PVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFLDVFGEEVR
RVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSLR
NMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPSAEPRDKWTRRLRLSRTLAAKVELVDI
QREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLS
AIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDT
ELSCTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHSRGRDAVRESLIHVP
LETFLQTLESAGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHGTLSRVKAAQLVLAG
GPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHF
HTHPIPLESGGSADITLRSYVRAQGPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAA
GPPASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEP
PEAAPGRARAVENQYSFY
Download sequence
Identical sequences ENSPTRP00000033449 ENSPTRP00000033449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]