SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033466 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033466
Domain Number 1 Region: 53-189,236-368
Classification Level Classification E-value
Superfamily L domain-like 9.78e-41
Family Ngr ectodomain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033466   Gene: ENSPTRG00000019545   Transcript: ENSPTRT00000036200
Sequence length 441
Comment pep:known chromosome:CHIMP2.1.4:7:104386125:104419172:1 gene:ENSPTRG00000019545 transcript:ENSPTRT00000036200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVTIVILLCFCKAAELRKASPGTVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYL
HEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRILKNNMFSKFKKLKSLDLQQNEISKI
ESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQI
PRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDST
FCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLS
SNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHY
LYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDEE
WEKKHRDHTAKKQSVIITIVG
Download sequence
Identical sequences H2QV62
XP_001158135.1.37143 ENSPTRP00000033466 ENSPTRP00000033466 9598.ENSPTRP00000033466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]