SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033510 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033510
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EF-hand 0.000000627
Family Polcalcin 0.068
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033510   Gene: ENSPTRG00000019567   Transcript: ENSPTRT00000036246
Sequence length 149
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:107061165:107077122:-1 gene:ENSPTRG00000019567 transcript:ENSPTRT00000036246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSSRELQAAEYLEKHQIKELVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEV
NKRMKEICEKTKGKDSESYQTAAGLLLLR
Download sequence
Identical sequences H2QV74
ENSPTRP00000033510 ENSPTRP00000033510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]