SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033567 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000033567
Domain Number - Region: 309-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0317
Family Galectin (animal S-lectin) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033567   Gene: ENSPTRG00000019604   Transcript: ENSPTRT00000036308
Sequence length 527
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:114262105:114274138:1 gene:ENSPTRG00000019604 transcript:ENSPTRT00000036308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKSLRYCFSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARINLLVAICLGLYVRWEKTA
NSLILVIFILGLFVLGIASILYYYFSMEAASLSLSNLWFGFLLGLLCFLDNSSFKNDIKE
ESTKYLLLTSIVLRILCSLVERISGYVRHRPTLLTTVEFLELVGFAIASTTMLVEKSLSV
ILLVVALAMLIIDLRMKSFLAIPNLVIFAVLLFFSSLETPKNPIAFACFFICLITDPFLD
IYFSGLSVTERWKPFLYRGRICRRLSVVFAGMIELTFFILSAFKLRDTHLWYFVIPGFSI
FGIFWMICHIIFLLTLWGFHTKLNDCHKVYFTHRTDYNSLDRIMASKGMRHFCLISEQLV
FFSLLATAILGAVSWQPTNGIFLSMFLIVLPLESMAHGLFHELGNCLGGTSVGYAIVIPT
NFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSK
LKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGKLTFGSFTIVK
Download sequence
Identical sequences ENSPTRP00000033567 ENSPTRP00000033567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]