SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033744 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033744
Domain Number 1 Region: 31-334
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.51e-50
Family Haloalkane dehalogenase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033744   Gene: ENSPTRG00000019698   Transcript: ENSPTRT00000036497
Sequence length 335
Comment pep:known chromosome:CHIMP2.1.4:7:131976840:131991048:1 gene:ENSPTRG00000019698 transcript:ENSPTRT00000036497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ
DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI
FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI
FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR
NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Download sequence
Identical sequences A0A024R768 G3QE93 H2PNI9 H2QVE0 Q5EB52
ENSGGOP00000000585 ENSP00000223215 9598.ENSPTRP00000033744 9600.ENSPPYP00000020202 9606.ENSP00000223215 ENSPTRP00000033744 ENSNLEP00000015638 ENSGGOP00000000585 gi|29294639|ref|NP_002393.2| ENSPPYP00000020202 ENSP00000396504 ENSP00000463597 NP_002393.2.87134 NP_002393.2.92137 XP_002818499.1.23681 XP_003261387.1.23891 XP_003813517.1.60992 XP_004046269.1.27298 XP_519382.3.37143 ENSPTRP00000033744 ENSPPYP00000020202 ENSP00000223215 ENSP00000463277 ENSNLEP00000015640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]