SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033769 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033769
Domain Number 1 Region: 413-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.85e-38
Family Nucleotide and nucleoside kinases 0.00038
Further Details:      
 
Domain Number 2 Region: 132-359
Classification Level Classification E-value
Superfamily L domain-like 7.25e-36
Family Internalin LRR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033769   Gene: ENSPTRG00000019715   Transcript: ENSPTRT00000036524
Sequence length 825
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:135610790:135747778:1 gene:ENSPTRG00000019715 transcript:ENSPTRT00000036524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSERALLRTRAASLLRGLGRSRTGARSLQFRAEKERQPCWSFPVGQKTKGSSNIASSY
LLQQLMHRYQELDSDGDEDQGEGEAGSEESSESEMLNLEEEFDGVLREEAVAKALHHLGR
SGSGTEQVYLNLTLSGCNLIDVSILCGYVHLQKLDLSANKIEDLSCVSCMPYLLELNASQ
NNLTTFFNFKPPKNLKKADFSHNRISEICDLSAYHALTKLILDGNEIEEISGLEMCNNLI
HLSLANNKITTINGLNKLPIKILCLSNNQIEMITGLEDLKALQNLDLSHNQISSLQGLEN
HDLLEVINLEDNKIAELREIEYIKNLPILRVLNLLKNPIQEKSEYWFFVIFMLLRLTELD
QKKIKVEEKVSAVNKYDPPPEVVAAQDHLTHVVNSVMQPQRIFDSTLPSLDAPYPMLILA
GPEACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQDVFDEMVNMGKF
ILTFSYGNHKYGLNRDTVEGIARDGLASCIHMEIEGVRSLKYSYFEPRYILVVPMNKEKY
EGYLRRKGLFSRAEIEFAVSRVDLYIKINQNFPGYFDEVINADDLDVAYQKLSQLIREYL
GLTEEPAKSLATTADVKTSHLKPEAHPTKYISSNMGDFLHSTDRNYLVKLWAKLSAKKTP
AERDSIHRQHEAARQALMGRIRPDHTLLFQRGPVPAPLTSGLHYYTTLEELRKSFDLCED
YFKPPFGPYPEKSGKDSLVSMKCSLFLFCPWSKELPFQPPEGSISSHLGSGASDSETEET
RKALPIQSFSHEKESHQHRQHSVPVISRPGSNVKPTLPPIPQGRR
Download sequence
Identical sequences H2QVE5
XP_003813503.1.60992 XP_519392.2.37143 ENSPTRP00000033769 9598.ENSPTRP00000033769 ENSPTRP00000033769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]