SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033908 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033908
Domain Number 1 Region: 666-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.65e-60
Family Protein kinases, catalytic subunit 0.0000000725
Further Details:      
 
Domain Number 2 Region: 33-227
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-54
Family Ephrin receptor ligand binding domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 367-580
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-33
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 946-1017
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.44e-17
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Domain Number 5 Region: 296-360,406-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000785
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033908   Gene: ENSPTRG00000019796   Transcript: ENSPTRT00000036670
Sequence length 1020
Comment pep:known chromosome:CHIMP2.1.4:7:144408384:144416662:1 gene:ENSPTRG00000019796 transcript:ENSPTRT00000036670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSAAWAV
GPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFAS
FPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRC
QPGYQPARGDKACQACPRGLYKASAGNAPCSPCPARSHAANPAAPVCPCLEGFYRASSDP
PEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGG
GTCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINV
STSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSE
TNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSIL
GALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIREL
AREVDPAYIKIEEVIGTGSFGEVRRGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAA
VLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAA
AMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTS
SDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKD
RARRPHFDQLVAAFDKMIRKPDTLQACGDPGERPSQALLTPVALDFPCLDSPQAWLSAIG
LECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Download sequence
Identical sequences H2QVJ1
9598.ENSPTRP00000033908 ENSPTRP00000033908 ENSPTRP00000033908 XP_009452666.1.37143 XP_016813790.1.37143 XP_016813791.1.37143 XP_016813792.1.37143 XP_016813793.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]