SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033933 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033933
Domain Number 1 Region: 625-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-79
Family Protein kinases, catalytic subunit 0.0000000417
Further Details:      
 
Domain Number 2 Region: 27-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.1e-55
Family Ephrin receptor ligand binding domain 0.0000154
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-24
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 4 Region: 908-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.85e-20
Family SAM (sterile alpha motif) domain 0.00099
Further Details:      
 
Domain Number 5 Region: 261-334,370-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000373
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033933   Gene: ENSPTRG00000019811   Transcript: ENSPTRT00000036695
Sequence length 976
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:144940054:144957810:-1 gene:ENSPTRG00000019811 transcript:ENSPTRT00000036695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSMKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEGCVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLHWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFLPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVTQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRV
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD
Download sequence
Identical sequences H2QVJ8
ENSPTRP00000033933 9598.ENSPTRP00000033933 XP_016813813.1.37143 XP_519451.2.37143 ENSPTRP00000033933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]