SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034414 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034414
Domain Number 1 Region: 300-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-37
Family SPRY domain 0.00027
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 1.75e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000641
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034414   Gene: ENSPTRG00000020103   Transcript: ENSPTRT00000037239
Sequence length 493
Comment pep:known chromosome:CHIMP2.1.4:8:23577281:23603714:-1 gene:ENSPTRG00000020103 transcript:ENSPTRT00000037239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVC
KDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLC
CSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEA
AWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIER
LQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE
SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEV
ALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRI
CPLHISVKEELDG
Download sequence
Identical sequences H2QVX7 Q9UPQ4
ENSP00000301924 ENSPTRP00000034414 9598.ENSPTRP00000034414 9606.ENSP00000301924 ENSP00000301924 NP_741983.2.87134 NP_741983.2.92137 XP_003830853.1.60992 XP_519674.2.37143 ENSPTRP00000034414 ENSP00000301924 gi|94536782|ref|NP_741983.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]