SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034431 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034431
Domain Number 1 Region: 364-466
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000034431
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034431   Gene: ENSPTRG00000020113   Transcript: ENSPTRT00000037256
Sequence length 468
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:24175987:24295653:-1 gene:ENSPTRG00000020113 transcript:ENSPTRT00000037256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDT
AQLELYQLQVESNSSQLLLRRHAGLLDGLARRVGILGEELADVGGVLRGLNHSLSYDVAL
HRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
ISLAKGLPGERGTPGLPGPKGDDGKLGATGPMGMRGFKGDRGPKGEKGEKGDRAGDASGV
EAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFRGVEEVYRTAR
FGQGTGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDASVTCNRH
Download sequence
Identical sequences ENSPTRP00000034431 ENSPTRP00000034431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]