SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034664 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034664
Domain Number 1 Region: 722-1297
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.18e-184
Family Myeloperoxidase-like 0.00000000256
Further Details:      
 
Domain Number 2 Region: 35-238
Classification Level Classification E-value
Superfamily L domain-like 1.16e-41
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 233-323
Classification Level Classification E-value
Superfamily Immunoglobulin 9.76e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 329-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-22
Family I set domains 0.0069
Further Details:      
 
Domain Number 5 Region: 512-599
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-22
Family I set domains 0.0093
Further Details:      
 
Domain Number 6 Region: 412-506
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 1393-1452
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000879
Family VWC domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034664   Gene: ENSPTRG00000020241   Transcript: ENSPTRT00000037509
Sequence length 1463
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:49004018:49497685:-1 gene:ENSPTRG00000020241 transcript:ENSPTRT00000037509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRLFCWTTLFLLAGWCLPGLPCPSRCLCFKSTVRCMHLMLDHIPQVPQQTTVLDLRFN
RIREIPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLYLYLYKNEIHALDKQTFKG
LISLEHLYIHFNQLEMLQPETFGDLLRLERLFLHNNKLSKIPAGSFSNLDSLKRLRLDSN
ALVCDCDLMWLKELLQGFAQHGHTQAAATCEYPRRLHGRAVASVTVEEFNCQSPRITFEP
QDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQ
GVYQCMARNAAGEAKTQSAMLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATGDPHPH
ITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQ
FTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQ
HDQGQYECQAISSLGVKKVSVQLTVKPKALAVFTQLPQDTSVEVGKNINISCHAQGEPQP
IITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFLTVTAI
QGRQAGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMAR
AGEIFEHTLQLIRERVKQGLTVDLEDKEFRYNDLVSPRSLSLIANLSGCTARRPLPNCSN
RCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYQDGIRAPRGLGLPVGSRQPLPPP
RLVATVWARAAAVTPDHSNTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDP
PCFPMNTRHADPRGTHAPCMLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVY
GSSERESQALRDPSVPRGLLRTGFPWPASGKPLLPFSTGPPTECARQEQDSPCFLAGDHR
ANEHLALTAMHTLWFREHNRVATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPK
VLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLP
FHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAAYSAAVDSAAT
IIQRGRDHGIPPYADFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPAL
MVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLGRVLCDN
GDSIQQVQADVFVKAEYPQDYLSCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRS
AQYSYPDDKDMELSHLRSRQQDKIYVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALR
EQINKLEARLRQAGCTDVKGVPRKAEERWMKEDCTHCICESGQVTCVVEICPPAPCPSPE
LVKGTCCPVCRDRGMPSDSPEKR
Download sequence
Identical sequences ENSPTRP00000034664 ENSPTRP00000034664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]