SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034788 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034788
Domain Number 1 Region: 94-133
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034788   Gene: ENSPTRG00000020325   Transcript: ENSPTRT00000037640
Sequence length 538
Comment pep:known chromosome:CHIMP2.1.4:8:66198026:66681265:1 gene:ENSPTRG00000020325 transcript:ENSPTRT00000037640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPLASELSELAALRPGFRLSAPHARVSPRAATHARGRGRASHAGQPRIRSSCPGPSPG
KRRVVPSGGAQPRVLPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETP
DQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKK
PKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKAL
ENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQ
WESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDN
EDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNL
EERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDGFEKASKLTGPGEASSGVGHSLK
NYMEEDESLKQLQVIHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL
Download sequence
Identical sequences H2QW99
NP_001186058.1.37143 ENSPTRP00000034788 ENSPTRP00000034788 9598.ENSPTRP00000034788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]