SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034843 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034843
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034843   Gene: ENSPTRG00000020364   Transcript: ENSPTRT00000037700
Sequence length 308
Comment pep:known chromosome:CHIMP2.1.4:8:77815953:77819810:-1 gene:ENSPTRG00000020364 transcript:ENSPTRT00000037700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGS
LGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRP
WGTEIGAF
Download sequence
Identical sequences A0A2J8M9W8 A0A2J8VA05 G3R3A1
gi|105990526|ref|NP_001035798.1| ENSP00000346761 9598.ENSPTRP00000034843 9606.ENSP00000338272 ENSPTRP00000034843 ENSP00000338272 ENSGGOP00000009725 NP_001035798.1.87134 NP_001035798.1.92137 XP_008954913.1.60992 XP_009242170.1.23681 XP_009453814.1.37143 XP_018888431.1.27298 ENSP00000338272 ENSGGOP00000009725 ENSPTRP00000034843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]