SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034906 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034906
Domain Number 1 Region: 60-81,168-245,287-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000112
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000034906
Domain Number - Region: 56-96,292-361,415-526
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0116
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034906   Gene: ENSPTRG00000020406   Transcript: ENSPTRT00000037766
Sequence length 549
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:88094113:88119489:1 gene:ENSPTRG00000020406 transcript:ENSPTRT00000037766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
FPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEG
SMLTISFGSWMELPGLKFKDWVSSKRRKLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYRDQDDDDSQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADA
ILCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYT
SFPEHHVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQP
ITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFV
ERGGGDGIA
Download sequence
Identical sequences H2QWE6
XP_528185.2.37143 ENSPTRP00000034906 ENSPTRP00000034906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]