SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035127 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035127
Domain Number 1 Region: 1010-1211
Classification Level Classification E-value
Superfamily vWA-like 2.54e-58
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 143-337
Classification Level Classification E-value
Superfamily vWA-like 2.67e-57
Family Integrin A (or I) domain 0.0000943
Further Details:      
 
Domain Number 3 Region: 1230-1433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-34
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number 4 Region: 536-702
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 739-909
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 354-440
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-17
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 7 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 446-532
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 922-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000656
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035127   Gene: ENSPTRG00000020539   Transcript: ENSPTRT00000038001
Sequence length 1796
Comment pep:known chromosome:CHIMP2.1.4:8:118733674:118981306:1 gene:ENSPTRG00000020539 transcript:ENSPTRT00000038001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFQRKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTLCSRVEEQDREIKASAHAITGPPTELI
TSEVTARSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGTVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASDLLLYDVTENSMRVKWDAVPGASGYLILYAPLT
EGLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNVGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
IAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLKEEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIVPTTSVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYMTAQGDPEEEV
IGTVMVPGSQNNLLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSGPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAKHIEMTSLCAHWQVHRHATAYRVVIESLQDRQK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSLPTRPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIISFLYSTVGALHKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVV
ITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPMVHKDGIDLAGFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFP
CYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVI
LDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGE
KATNASANITSDGVEVLGKMVQSRGPGGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRD
DESCPDLPHSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEIGLPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDG
SSGPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRSVA
RQVCEQLIQSHMARYTAILNQIPSHSSSIRTVQGPPGEPGRPGSPGAPGEQGPPGTPGFP
GNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGP
PGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPDQPEFTPVQDELEAMELWGPGV
Download sequence
Identical sequences A0A2I3S4E5
XP_016815298.1.37143 ENSPTRP00000035127 9598.ENSPTRP00000035127 ENSPTRP00000035127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]