SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035210 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035210
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 4.08e-30
Family U2A'-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000035210
Domain Number - Region: 316-384
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000141
Family Nuclear movement domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035210   Gene: ENSPTRG00000020595   Transcript: ENSPTRT00000038084
Sequence length 466
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:131259088:131361730:-1 gene:ENSPTRG00000020595 transcript:ENSPTRT00000038084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKTLQHNIHLKELFL
MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKR
AKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDHLQAPDIEEHNTKKL
DNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKNQEKLSEKKKKVKPPRTLIAEDGKALN
VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPFQLVLPAEVKP
DSSSAKRSQTTGHLVICMPKVGEVITGGRRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI
Download sequence
Identical sequences A0A2J8KF54
ENSPTRP00000035210 ENSPTRP00000035210 9598.ENSPTRP00000035210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]