SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035343 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035343
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily L domain-like 5.33e-54
Family Internalin LRR domain 0.093
Further Details:      
 
Domain Number 2 Region: 239-392
Classification Level Classification E-value
Superfamily L domain-like 7.99e-28
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 848-959
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-25
Family PDZ domain 0.0000404
Further Details:      
 
Domain Number 4 Region: 721-816
Classification Level Classification E-value
Superfamily PDZ domain-like 8.54e-25
Family PDZ domain 0.0000236
Further Details:      
 
Domain Number 5 Region: 1009-1100
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-24
Family PDZ domain 0.0056
Further Details:      
 
Domain Number 6 Region: 1103-1198
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family PDZ domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035343   Gene: ENSPTRG00000020669   Transcript: ENSPTRT00000038228
Sequence length 1486
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:142419928:142725102:-1 gene:ENSPTRG00000020669 transcript:ENSPTRT00000038228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSDACPCQPDSGSPLSAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEDTEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPQAQKEE
EEEEEEEGSPREEEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIE
PARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGD
KLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRE
RRGGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIA
EGGAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSP
LPHSSPPTAAVATTSTTTTSITTATPGEPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGP
LGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQE
AVSALLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEG
IFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFE
ASTAAALEVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEA
TEAAGRGLQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAECPCFPSGQQPPSPPSPDEL
PANVKQAYRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGP
PKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQP
PWASPSPTSRAPAHHPPLGGGLPQPLPHARYQGREGTLWGSPEPPA
Download sequence
Identical sequences ENSPTRP00000035343 ENSPTRP00000035343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]