SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035404 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035404
Domain Number 1 Region: 195-407,435-534
Classification Level Classification E-value
Superfamily RNI-like 6.02e-25
Family 28-residue LRR 0.094
Further Details:      
 
Domain Number 2 Region: 105-163
Classification Level Classification E-value
Superfamily F-box domain 0.00000000235
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035404   Gene: ENSPTRG00000020696   Transcript: ENSPTRT00000038291
Sequence length 539
Comment pep:known chromosome:CHIMP2.1.4:8:143255817:143258979:-1 gene:ENSPTRG00000020696 transcript:ENSPTRT00000038291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQAPPGPSAAAKPKAGLRPEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVM
LAKACCQLHSLDLQHSMVESTAVVSFLKEAGSRMRKFWLTYSSQTTAILGALLGSCCPQL
QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPLGRGVAPGPGFPSLEE
LCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNL
RGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
Download sequence
Identical sequences H2QWW7
ENSPTRP00000035404 9598.ENSPTRP00000035404 ENSPTRP00000035404 XP_016801820.1.37143 XP_528267.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]