SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035630 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035630
Domain Number 1 Region: 38-226
Classification Level Classification E-value
Superfamily L domain-like 2.55e-27
Family Ngr ectodomain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035630   Gene: ENSPTRG00000020834   Transcript: ENSPTRT00000038545
Sequence length 370
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:27377087:27389689:-1 gene:ENSPTRG00000020834 transcript:ENSPTRT00000038545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQIT
LNGTDTRVLQTYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGL
NKLKQLYLCQNKIEQLNADVFVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNC
SCSLFNLQNWLNTSNVTLENENITMCSYPNSLQSYNIKTVPHKAECHSKFPSSVTEDLYI
HFQPISNSTFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTVLTTSLLIFIAIKCPIWYNIL
LSYNHHRLEEHEAETHEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVVDDDGFIEDKY
IDIHELREEN
Download sequence
Identical sequences H2QX36
ENSPTRP00000035630 XP_001154402.1.37143 XP_003830745.1.60992 ENSPTRP00000035630 9598.ENSPTRP00000035630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]