SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035787 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035787
Domain Number 1 Region: 55-160
Classification Level Classification E-value
Superfamily HIT-like 3.09e-56
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035787   Gene: ENSPTRG00000020923   Transcript: ENSPTRT00000038711
Sequence length 163
Comment pep:known chromosome:CHIMP2.1.4:9:36248610:36250694:-1 gene:ENSPTRG00000020923 transcript:ENSPTRT00000038711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRIL
DKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQ
TAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
Download sequence
Identical sequences G3R6M3 H2QX91 Q9BX68
ENSPTRP00000035787 NP_115982.1.87134 NP_115982.1.92137 XP_001158309.1.37143 XP_003829896.1.60992 XP_004048056.1.27298 ENSPTRP00000035787 ENSP00000259667 ENSGGOP00000010985 ENSP00000259667 4njy_A 4njz_A 4njz_B 4njz_C 4njz_D 4nk0_A 4nk0_B ENSGGOP00000010985 9598.ENSPTRP00000035787 9606.ENSP00000259667 gi|14211923|ref|NP_115982.1| ENSP00000259667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]