SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036078 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036078
Domain Number 1 Region: 92-276
Classification Level Classification E-value
Superfamily L domain-like 1.8e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036078   Gene: ENSPTRG00000021111   Transcript: ENSPTRT00000039043
Sequence length 298
Comment pep:known chromosome:CHIMP2.1.4:9:91194839:91215701:-1 gene:ENSPTRG00000021111 transcript:ENSPTRT00000039043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLQSTLLLLLFVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEK
ETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLL
KLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIH
LQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
Download sequence
Identical sequences A0A2J8WP60 H2QXG4 Q5RBL2
ENSPPYP00000021715 ENSPPYP00000021715 ENSPTRP00000036078 9598.ENSPTRP00000036078 9600.ENSPPYP00000021715 ENSPTRP00000036078 NP_001125484.1.23681 XP_001145422.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]