SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036079 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036079
Domain Number 1 Region: 66-358
Classification Level Classification E-value
Superfamily L domain-like 5.95e-50
Family Ngr ectodomain-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036079   Gene: ENSPTRG00000021112   Transcript: ENSPTRT00000039044
Sequence length 421
Comment pep:known chromosome:CHIMP2.1.4:9:91225279:91235565:-1 gene:ENSPTRG00000021112 transcript:ENSPTRT00000039044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTL
GCVSECFCPTNFPSSMYCDNRKLKAIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEI
NLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQAN
AMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCNNRLESMPPGLPSSLMYLSL
ENNSISSIPEKYFDKLPKLRTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPR
NLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTI
YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ
E
Download sequence
Identical sequences H2QXG5
ENSPTRP00000036079 XP_001146339.1.37143 XP_016816632.1.37143 ENSPTRP00000036079 9598.ENSPTRP00000036079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]