SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036080 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036080
Domain Number 1 Region: 71-356
Classification Level Classification E-value
Superfamily L domain-like 1.7e-56
Family Ngr ectodomain-like 0.000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036080   Gene: ENSPTRG00000021113   Transcript: ENSPTRT00000039045
Sequence length 378
Comment pep:known chromosome:CHIMP2.1.4:9:91267460:91294510:-1 gene:ENSPTRG00000021113 transcript:ENSPTRT00000039045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDEDNSLFPTREP
RSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPLDTRMLDLQNNKIKEIKENDF
KGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENK
VKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPT
LLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNKLK
KIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEMQPA
TFRCVLSRMSVQLGNFGM
Download sequence
Identical sequences H2QXG6
9598.ENSPTRP00000036080 ENSPTRP00000036080 XP_001146178.1.37143 ENSPTRP00000036080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]