SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036082 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036082
Domain Number 1 Region: 328-682
Classification Level Classification E-value
Superfamily L domain-like 1.84e-47
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 100-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000921
Family VWC domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036082   Gene: ENSPTRG00000021114   Transcript: ENSPTRT00000039047
Sequence length 701
Comment pep:known chromosome:CHIMP2.1.4:9:91307258:91348288:-1 gene:ENSPTRG00000021114 transcript:ENSPTRT00000039047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVLFCFFLLIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIPQTTVF
TPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPC
TTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGDS
SEQREPTNLLHKQLPPPQVGMDQIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLYS
EGDSRGGDRKQRPGKERRLAHQQQRQGREEEEDEEDEEEEGEEGEEDEEDEEDPVRGDMF
RMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASI
PDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQVPSQLPSTLEE
LKVNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRI
IPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLE
SIDLSFNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGM
DRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDD
DSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK
Download sequence
Identical sequences H2QXG7
XP_003312214.1.37143 XP_009455169.1.37143 XP_016816629.1.37143 9598.ENSPTRP00000036082 ENSPTRP00000036082 ENSPTRP00000036082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]