SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036093 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036093
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036093
Domain Number - Region: 87-146
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0238
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036093   Gene: ENSPTRG00000021122   Transcript: ENSPTRT00000039059
Sequence length 254
Comment pep:known chromosome:CHIMP2.1.4:9:91875687:91903154:1 gene:ENSPTRG00000021122 transcript:ENSPTRT00000039059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFH
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMS
MAFLTCCLLKCVKKSERRRSNRSAQLWSQLKDEDLTVQAAYLGLKHFNKPVSGPSQAHDN
HSFTTDHGESTSKLASVTRSVDKDPGIPRALSLSGSSSSPQAQVMVHMANPRQPLPASGL
ATGMPQQPAAYALG
Download sequence
Identical sequences ENSPTRP00000036093 ENSPTRP00000036093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]