SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036183 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036183
Domain Number 1 Region: 259-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-52
Family SPRY domain 0.00024
Further Details:      
 
Domain Number 2 Region: 21-79
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000116
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036183   Gene: ENSPTRG00000021174   Transcript: ENSPTRT00000039154
Sequence length 442
Comment pep:known chromosome:CHIMP2.1.4:9:96872777:96908665:-1 gene:ENSPTRG00000021174 transcript:ENSPTRT00000039154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAAAGTRTPGRSELVERCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGL
ALEAAVHVQKLSQECLKQLAIKKQQHVDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDVMNDLSNRVWSIGQEPDPVQRLQA
YTATEQEMQQQMSLGELCHPVPLSFEPVKSFFKSLVEAVESILQMPLDIRLKESINCQLS
DPSSTKPGTLLKTSPSPQRSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV
PALRFDALWQVLARDCFAAGRHYWEVDVQEAGAGWWVGAAYASLRRRGASAAARLGCNRQ
SWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT
FQEPLYPALRLWEGAISIPRLP
Download sequence
Identical sequences H2QXJ9
ENSPTRP00000036183 ENSPTRP00000036183 XP_009455255.1.37143 XP_016816794.1.37143 XP_520143.2.37143 9598.ENSPTRP00000036183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]