SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036222 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036222
Domain Number 1 Region: 80-145
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.46e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 272-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000838
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 180-237
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036222   Gene: ENSPTRG00000021194   Transcript: ENSPTRT00000039194
Sequence length 382
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:99290225:99397537:1 gene:ENSPTRG00000021194 transcript:ENSPTRT00000039194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGSGSGGDCPGGK
GKSINCSELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTY
QNECFLRRAACKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAE
CDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDT
DDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKAS
CRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKN
NRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences H2QXL2
XP_001134837.1.37143 9598.ENSPTRP00000036222 ENSPTRP00000036222 ENSPTRP00000036222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]