SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036259 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036259
Domain Number 1 Region: 349-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-34
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 187-298
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000177
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036259
Domain Number - Region: 40-147
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000196
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036259   Gene: ENSPTRG00000021222   Transcript: ENSPTRT00000039240
Sequence length 530
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:104337758:104437695:1 gene:ENSPTRG00000021222 transcript:ENSPTRT00000039240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDT
LHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCN
NALENSEELLEFATRSLDIKEPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVD
FSQERQMLQTLKFLPVPKAPEIDPVECLVADNSVTVAWRMPEEDNKIDHFILEHRKTNFD
GLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRACNKAVAGEYSDPVTLETKAL
NFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKRTSVGSRPPAV
RGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSW
CIHVNNWLQNTFAAKHNNKVKALDVTVPEKLGVFCDFDGGQLSFYDANSKQLLYSFKTKF
TQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ
Download sequence
Identical sequences A0A2J8LPN6
ENSPTRP00000036259 ENSPTRP00000036259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]