SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036343 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036343
Domain Number 1 Region: 231-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-39
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000104
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036343   Gene: ENSPTRG00000021277   Transcript: ENSPTRT00000039332
Sequence length 402
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:112286223:112307887:1 gene:ENSPTRG00000021277 transcript:ENSPTRT00000039332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGSEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAE
ERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSL
CESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKE
QEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTQLWATAVLGSLSGTEDIRIDERTVS
PFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKV
GVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDL
QAQELLFYEPASGTVLCAHHGSFPGPLFPVFAVADQTISIVR
Download sequence
Identical sequences H2QXQ7
XP_528397.2.37143 ENSPTRP00000036343 9598.ENSPTRP00000036343 ENSPTRP00000036343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]