SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036381 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036381
Domain Number 1 Region: 1971-2194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.66e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 7.5e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1801-1965
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-21
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-20
Family Fibronectin type III 0.0000204
Further Details:      
 
Domain Number 5 Region: 624-786
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000177
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000535
Family Fibronectin type III 0.00000287
Further Details:      
 
Domain Number 8 Region: 1621-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000115
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000246
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 10 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000289
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 11 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000419
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 12 Region: 1530-1617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000116
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 13 Region: 1441-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000177
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036381
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000183
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00099
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00236
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00602
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00693
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00914
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.016
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0236
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036381   Gene: ENSPTRG00000021294   Transcript: ENSPTRT00000039376
Sequence length 2201
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:113971447:114069234:-1 gene:ENSPTRG00000021294 transcript:ENSPTRT00000039376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGRCIDGQCICDEGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSHEICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQRSCPSDCNN
LGQCVSGRCICNEGYSGADCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAAQNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGKTPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSVEIPGLRAGT
PYTITLHGEVRGHSTRPLAVQVVTEELPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWTATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VMVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQPVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences H2QXR9
ENSPTRP00000036381 ENSPTRP00000036381 XP_001156720.1.37143 9598.ENSPTRP00000036381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]