SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036394 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036394
Domain Number 1 Region: 1062-1110,1141-1182
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000201
Family Fibronectin type III 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036394
Domain Number - Region: 650-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family Merozoite surface protein 1 (MSP-1) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036394   Gene: ENSPTRG00000021297   Transcript: ENSPTRT00000039389
Sequence length 1335
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:115396281:116386969:-1 gene:ENSPTRG00000021297 transcript:ENSPTRT00000039389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTASEPISPGHHSVLRVQPRICFHPGPPPLLPLLLLLFLLAKQPPPLLAGATAAASREP
DSPCRLKTVTVSTLPALRESDIGWSGARAGAGAGTGAGAAAAASPGSPGSAGTAAESRLL
LFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSS
GQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRRRIP
QKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDCEEDEE
PPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKAAAEATQETVESLMQKFKESFR
ANTPIEIGQLQPPLRSTSAGKRKRRSKSRGGISFGRAKGTSGSEADDETQLTFYTEQYRS
RRRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVV
SEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCHEGYA
PDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILSLGQGLWLPVSKSFVVP
PVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTR
NFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLPY
DATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGYNNR
TQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIR
YDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNVLKILTKESSREELLSFIQHYGSHY
IAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLTAQML
SDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKE
AFKSALMSSYWCSGKGDVIDDWCRCDLSAFDASGLPNCSPLPQPVLRLSPTVEPSSTVVS
LEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHG
EVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADK
IYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAH
LILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEK
MVSMARNTYGESKGR
Download sequence
Identical sequences ENSPTRP00000036394 ENSPTRP00000036394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]