SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036412 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036412
Domain Number 1 Region: 140-406
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.46e-43
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 52-127
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000157
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036412   Gene: ENSPTRG00000021304   Transcript: ENSPTRT00000039407
Sequence length 454
Comment pep:known chromosome:CHIMP2.1.4:9:119792955:119822241:-1 gene:ENSPTRG00000021304 transcript:ENSPTRT00000039407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLL
PLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWK
KVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQC
VYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDI
LVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVKSLLHSPGDYILLSADKYE
IKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQWDFASYDILRV
IKTPEIANLALLGFGDIFALLFDNRYLYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEA
SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Download sequence
Identical sequences A0A0D9RL67 A0A2K5DNW9 A0A2K6F1G3 D2H313 E2R6D8 F7BE28 G1SPD0 H2QXS8 M3X9R3 M3Y8L7 Q9UKT8
NP_036296.2.87134 NP_036296.2.92137 XP_002720550.1.1745 XP_002916003.1.58354 XP_003833138.1.60992 XP_003995853.1.62641 XP_004269327.1.21590 XP_004411604.1.74151 XP_004595014.1.84141 XP_004775692.1.14098 XP_005251967.1.92137 XP_006747765.1.47382 XP_006747766.1.47382 XP_006747767.1.47382 XP_007451554.1.90284 XP_007966426.1.81039 XP_008697053.1.72690 XP_008956855.1.60992 XP_009455449.1.37143 XP_009455450.1.37143 XP_012313667.1.9421 XP_012313668.1.9421 XP_012388265.1.21590 XP_012519891.1.63892 XP_012519892.1.63892 XP_012519893.1.63892 XP_012627126.1.48125 XP_017831319.1.60252 XP_019309559.1.44245 XP_019802036.1.83887 XP_019802038.1.83887 XP_021546942.1.83697 XP_520223.2.37143 XP_853711.1.84170 ENSPTRP00000036412 ENSMPUP00000007674 ENSCJAP00000037803 gi|118402584|ref|NP_036296.2| ENSAMEP00000001284 ENSCAFP00000005310 ENSMICP00000002987 ENSCJAP00000037805 9598.ENSPTRP00000036412 9606.ENSP00000363036 9615.ENSCAFP00000005310 9986.ENSOCUP00000004893 ENSAMEP00000001284 ENSP00000476369 ENSP00000476369 ENSMPUP00000007674 ENSOCUP00000004893 ENSOCUP00000004893 ENSFCAP00000023366 ENSTTRP00000006262 ENSMICP00000002987 ENSPTRP00000036412 ENSCAFP00000005310 ENSP00000341161 ENSTTRP00000006262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]